PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000044.1_g00054.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 411aa    MW: 45925.6 Da    PI: 7.1678
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000044.1_g00054.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM154.25.9e-48271741128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk......................kvkaeekewyfFskr 64 
                              + pGfrF+Ptdeel+++yLkkk+eg++  + evi+ev+i k+ePwdLp                       +v ++++ew+fFs+r
  Itr_sc000044.1_g00054.1  27 MFPGFRFSPTDEELISYYLKKKLEGSDRCV-EVISEVEIWKHEPWDLPGclscftlvfdltntiacvgavkSVIQSDNEWFFFSPR 111
                              579************************777.99***************6689*********99999987764445889******** PP

                      NAM  65 dkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               +ky++g++++rat+sgyWkatgk+++v+s +++++g+k+tLvf++grapkg++t+W+mhey +
  Itr_sc000044.1_g00054.1 112 GRKYPNGSQSRRATESGYWKATGKERNVKS-GSNVIGTKRTLVFHTGRAPKGQRTQWIMHEYCM 174
                              ******************************.99*****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-5123191IPR003441NAC domain
PROSITE profilePS5100550.97827192IPR003441NAC domain
PfamPF023654.0E-2629173IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MGDGHASCSR NSNNNSTEIP LATASAMFPG FRFSPTDEEL ISYYLKKKLE GSDRCVEVIS  60
EVEIWKHEPW DLPGCLSCFT LVFDLTNTIA CVGAVKSVIQ SDNEWFFFSP RGRKYPNGSQ  120
SRRATESGYW KATGKERNVK SGSNVIGTKR TLVFHTGRAP KGQRTQWIMH EYCMNGRSQP  180
QDSMVVCRLR KNNEFHLNEA PRNQMNNSNA NNSMTALSGA DPAGSSGGVN AGESCSKECS  240
SSFNSHSVEQ IDSDSDSDSD EKLVNEISLH HPPGNQKDFF DAEDWFADIM KDDIIKLDDS  300
SLNPRLDALP ATTTKPEPEP QQNQATAAQG FTPDLFPFQG TANRRLRLRK EAARGEPFQL  360
DKQQLLPRRL VSMMSRGRIK HCSIYVCFLS LIILLFCCSG LLLRLENLMN K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-392319313166NO APICAL MERISTEM PROTEIN
1ut4_B1e-392319313166NO APICAL MERISTEM PROTEIN
1ut7_A1e-392319313166NO APICAL MERISTEM PROTEIN
1ut7_B1e-392319313166NO APICAL MERISTEM PROTEIN
3swm_A9e-402319316169NAC domain-containing protein 19
3swm_B9e-402319316169NAC domain-containing protein 19
3swm_C9e-402319316169NAC domain-containing protein 19
3swm_D9e-402319316169NAC domain-containing protein 19
3swp_A9e-402319316169NAC domain-containing protein 19
3swp_B9e-402319316169NAC domain-containing protein 19
3swp_C9e-402319316169NAC domain-containing protein 19
3swp_D9e-402319316169NAC domain-containing protein 19
4dul_A1e-392319313166NAC domain-containing protein 19
4dul_B1e-392319313166NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1343349RRLRLRK
2343350RRLRLRKE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006361089.11e-161PREDICTED: NAC domain-containing protein 89-like isoform X1
RefseqXP_004241333.11e-161PREDICTED: NAC domain-containing protein 89-like
TrEMBLK4C9D51e-161K4C9D5_SOLLC; Uncharacterized protein
TrEMBLM1A5E51e-161M1A5E5_SOLTU; Uncharacterized protein
STRINGSolyc06g074170.2.11e-160(Solanum lycopersicum)
STRINGPGSC0003DMT4000150771e-160(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41542243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27300.18e-74NTM1-like 8